Anti-12 Lipoxygenase antibody - C-terminal (ab211506)

Overview

  • Product name
    Anti-12 Lipoxygenase antibody - C-terminal
    See all 12 Lipoxygenase primary antibodies
  • Description
    Rabbit polyclonal to 12 Lipoxygenase - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human 12 Lipoxygenase aa 618-650 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). NCBI Accession No. NP_000688.2.
    Sequence:

    PKPKAVLNQFRTDLEKLEKEITARNEQLDWPYE


    Database link: P18054

  • Positive control
    • K562 cell lysate; Human heart tisue; A549 and K562 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab211506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 76 kDa.
Flow Cyt 1/10 - 1/50.
ICC/IF 1/10 - 1/50.
IHC-P 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Oxygenase and 14,15-leukotriene A4 synthase activity.
  • Pathway
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities
    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 12 LOX antibody
    • 12(S) lipoxygenase antibody
    • 12-lipoxygenase antibody
    • 12LO antibody
    • 12S LOX antibody
    • 12S-lipoxygenase antibody
    • 12S-LOX antibody
    • 12S-type antibody
    • Alox12 antibody
    • Arachidonate 12 lipoxygenase antibody
    • Arachidonate 12 lipoxygenase, 12S type antibody
    • Arachidonate 12-lipoxygenase antibody
    • Arachidonate 12-oxidoreductase antibody
    • Lipoxin synthase 12-LO antibody
    • LOG12 antibody
    • LOX12_HUMAN antibody
    • P-12LO antibody
    • Platelet 12-LOX antibody
    • Platelet type lipoxygenase 12 antibody
    • platelet-type 12-lipoxygenase antibody
    • Platelet-type lipoxygenase 12 antibody
    see all

Images

  • Anti-12 Lipoxygenase antibody - C-terminal (ab211506) at 1/1000 dilution + K562 cell lysate at 35 µg

    Predicted band size: 76 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human heart tissue, labeling 12 Lipoxygenase using ab211506 at a 1/50 dilution.

  • Immunofluorescence analysis of A549 cells, labeling 12 Lipoxygenase using ab211506 at a 1/100 dilution. Alexa Fluor 488-conjugated goat anti-rabbit lgG at 1/400 dilution was used as the secondary antibody (green). Cytoplasmic actin was counterstained with Dylight Fluor 554 (red) conjugated Phalloidin (red).

  • Flow Cytometry analysis of K562 cells labeling 12 Lipoxygenase (bottom histogram), using ab211506 at a 1/10 dilution, and negative control cells (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

References

ab211506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up