Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618)

Overview

  • Product name
    Anti-14-3-3 alpha + beta antibody - C-terminal
    See all 14-3-3 alpha + beta primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 alpha + beta - C-terminal
  • Specificity
    This product cross-reacts with 14-3-3 gamma, delta and epsilon.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide aa 200-246 (C terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    EAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN


    Database link: P31946

  • Positive control
    • Mouse brain lysate; Human rectal carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 31 kDa (predicted molecular weight: 28 kDa).
IHC-P 1/50 - 1/200.

(using a fluorescent secondary antibody).

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    The alpha, brain-specific form differs from the beta form in being phosphorylated.
    Isoform Short contains a N-acetylmethionine at position 1.
  • Cellular localization
    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 alpha antibody
    • 14 3 3 protein beta/alpha antibody
    • 14-3-3 protein beta/alpha antibody
    • 1433B_HUMAN antibody
    • Brain protein 14 3 3 beta isoform antibody
    • GW128 antibody
    • HS 1 antibody
    • KCIP-1 antibody
    • KCIP1 antibody
    • N-terminally processed antibody
    • Protein 1054 antibody
    • Protein kinase C inhibitor protein 1 antibody
    • YWHAA antibody
    • YWHAB antibody
    see all

Images

  • All lanes : Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618) at 1/200 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    Goat anti-rabbit IgG (H+L), HRP conjugated at 1/3000 dilution

    Predicted band size : 28 kDa
    Observed band size : 31 kDa (why is the actual band size different from the predicted?)

    12% gel

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human rectal carcinoma tissue labeling 14-3-3 alpha + beta with ab216618 at 1/200 dilution, followed by Goat anti-Rabbit IgG, PE conjugted at 1/200 dilution.

References

ab216618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up