Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618)

Overview

  • Product name
    Anti-14-3-3 alpha + beta antibody - C-terminal
    See all 14-3-3 alpha + beta primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 alpha + beta - C-terminal
  • Specificity
    This product cross-reacts with 14-3-3 gamma, delta and epsilon.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide aa 200-246 (C terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    EAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN


    Database link: P31946

  • Positive control
    • Mouse brain lysate; Human rectal carcinoma tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab216618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 31 kDa (predicted molecular weight: 28 kDa).
IHC-P 1/50 - 1/200.

(using a fluorescent secondary antibody).

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    The alpha, brain-specific form differs from the beta form in being phosphorylated.
    Isoform Short contains a N-acetylmethionine at position 1.
  • Cellular localization
    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 alpha antibody
    • 14 3 3 protein beta/alpha antibody
    • 14-3-3 protein beta/alpha antibody
    • 1433B_HUMAN antibody
    • Brain protein 14 3 3 beta isoform antibody
    • GW128 antibody
    • HS 1 antibody
    • KCIP-1 antibody
    • KCIP1 antibody
    • N-terminally processed antibody
    • Protein 1054 antibody
    • Protein kinase C inhibitor protein 1 antibody
    • YWHAA antibody
    • YWHAB antibody
    see all

Anti-14-3-3 alpha + beta antibody - C-terminal images

  • All lanes : Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618) at 1/200 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    Goat anti-rabbit IgG (H+L), HRP conjugated at 1/3000 dilution

    Predicted band size : 28 kDa
    Observed band size : 31 kDa (why is the actual band size different from the predicted?)

    12% gel

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human rectal carcinoma tissue labeling 14-3-3 alpha + beta with ab216618 at 1/200 dilution, followed by Goat anti-Rabbit IgG, PE conjugted at 1/200 dilution.

References for Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618)

ab216618 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab216618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up