Overview

  • Product name
    Anti-14-3-3 epsilon antibody
    See all 14-3-3 epsilon primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 epsilon
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human 14-3-3 epsilon aa 2-254. (With tag; BC000179).
    Sequence:

    DDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKN VIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDIL DVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVA YKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDD AIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVE DENQ


    Database link: P62258

  • Positive control
    • Mouse brain tissue lysate; HT29, 293T and HeLa cell lysates; Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab182656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.
IHC-P 1/25 - 1/150.

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Cellular localization
    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 E antibody
    • 14 3 3 epsilon antibody
    • 14 3 3E antibody
    • 14-3-3 protein epsilon antibody
    • 14-3-3E antibody
    • 1433E_HUMAN antibody
    • Epididymis luminal protein 2 antibody
    • FLJ45465 antibody
    • FLJ53559 antibody
    • HEL2 antibody
    • KCIP 1 antibody
    • KCIP1 antibody
    • MDCR antibody
    • MDS antibody
    • Mitochondrial import stimulation factor L subunit antibody
    • Protein kinase C inhibitor protein1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon polypeptide antibody
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide antibody
    • YWHAE antibody
    see all

Anti-14-3-3 epsilon antibody images

  • Immunohistochemical analysis of paraffin-embedded Human colon cancer tissue lableing 14-3-3 epsilon with ab182656 at 1/10 dilution (left panel). Right panel is treated with the immunogen.

  • All lanes : Anti-14-3-3 epsilon antibody (ab182656) at 1/250 dilution

    Lane 1 : HT29 cell lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : 293T cell lysate
    Lane 4 : HeLa cell lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    Donkey anti Rabbit IgG - H&L (HRP) at 1/3000 dilution
    Developed using the ECL technique

    Predicted band size : 29 kDa


    Exposure time : 1 second

    10% SDS PAGE

References for Anti-14-3-3 epsilon antibody (ab182656)

ab182656 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab182656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up