Overview

  • Product name
    Anti-14-3-3 epsilon antibody
    See all 14-3-3 epsilon primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 epsilon
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human 14-3-3 epsilon aa 2-254. (With tag; BC000179).
    Sequence:

    DDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKN VIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDIL DVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVA YKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDD AIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVE DENQ


    Database link: P62258

  • Positive control
    • Mouse brain tissue lysate; HT29, 293T and HeLa cell lysates; Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab182656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.
IHC-P 1/25 - 1/150.

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Cellular localization
    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 E antibody
    • 14 3 3 epsilon antibody
    • 14 3 3E antibody
    • 14-3-3 protein epsilon antibody
    • 14-3-3E antibody
    • 1433E_HUMAN antibody
    • Epididymis luminal protein 2 antibody
    • FLJ45465 antibody
    • FLJ53559 antibody
    • HEL2 antibody
    • KCIP 1 antibody
    • KCIP1 antibody
    • MDCR antibody
    • MDS antibody
    • Mitochondrial import stimulation factor L subunit antibody
    • Protein kinase C inhibitor protein1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon polypeptide antibody
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide antibody
    • YWHAE antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon cancer tissue lableing 14-3-3 epsilon with ab182656 at 1/10 dilution (left panel). Right panel is treated with the immunogen.

  • All lanes : Anti-14-3-3 epsilon antibody (ab182656) at 1/250 dilution

    Lane 1 : HT29 cell lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : 293T cell lysate
    Lane 4 : HeLa cell lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    Donkey anti Rabbit IgG - H&L (HRP) at 1/3000 dilution
    Developed using the ECL technique

    Predicted band size : 29 kDa


    Exposure time : 1 second

    10% SDS PAGE

References

ab182656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up