Overview

  • Product name
    Anti-14-3-3 eta antibody (FITC)
    See all 14-3-3 eta primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 eta (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human 14-3-3 eta aa 4-246.
    Sequence:

    REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVV GARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSL LDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAA YKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDD AIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN


    Database link: Q04917

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 28 kDa.

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificity
    Expressed mainly in the brain and present in other tissues albeit at lower levels.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 protein eta antibody
    • 14-3-3 eta antibody
    • 14-3-3 protein eta antibody
    • 1433F_HUMAN antibody
    • Brain protein 14-3-3, eta isoform antibody
    • HGNC:12853 antibody
    • Protein AS1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, eta isoform antibody
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta antibody
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide antibody
    • YWHA 1 antibody
    • YWHA1 antibody
    • Ywhah antibody
    see all

References for Anti-14-3-3 eta antibody (FITC) (ab193170)

ab193170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab193170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up