Overview

  • Product name
    Anti-14-3-3 eta antibody (FITC)
    See all 14-3-3 eta primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 eta (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human 14-3-3 eta aa 4-246.
    Sequence:

    REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVV GARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSL LDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAA YKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDD AIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN


    Database link: Q04917

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 28 kDa.

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificity
    Expressed mainly in the brain and present in other tissues albeit at lower levels.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 protein eta antibody
    • 14-3-3 eta antibody
    • 14-3-3 protein eta antibody
    • 1433F_HUMAN antibody
    • Brain protein 14-3-3, eta isoform antibody
    • HGNC:12853 antibody
    • Protein AS1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1 antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide antibody
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, eta isoform antibody
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta antibody
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide antibody
    • YWHA 1 antibody
    • YWHA1 antibody
    • Ywhah antibody
    see all

References

ab193170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up