Overview

  • Product name
    Anti-14-3-3 sigma antibody
    See all 14-3-3 sigma primary antibodies
  • Description
    Rabbit polyclonal to 14-3-3 sigma
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Dog, Monkey, Opossum
  • Immunogen

    Synthetic peptide within Human 14-3-3 sigma aa 120-170. The exact sequence is proprietary.
    Sequence:

    YLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIR L


    Database link: P31947

  • Positive control
    • IHC-P: Human tonsil, squamous epithelium tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab219789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.
    p53-regulated inhibitor of G2/M progression.
  • Tissue specificity
    Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    Ubiquitinated. Ubiquitination by RFFL induces proteasomal degradation and indirectly regulates p53/TP53 activation.
  • Cellular localization
    Cytoplasm. Nucleus. Secreted. May be secreted by a non-classical secretory pathway.
  • Information by UniProt
  • Database links
  • Alternative names
    • 14 3 3 protein sigma antibody
    • 14-3-3 protein sigma antibody
    • 1433S_HUMAN antibody
    • Epithelial cell marker protein 1 antibody
    • Er antibody
    • HME 1 antibody
    • HME1 antibody
    • MGC143283 antibody
    • Mkrn3 antibody
    • Mme1 antibody
    • OTTHUMP00000004242 antibody
    • RP23 137L22.11 antibody
    • SFN antibody
    • SFN protein antibody
    • Stratifin antibody
    • YWHAS antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil, squamous epithelium tissue labeling 14-3-3 sigma with ab219789 at 10 µg/mL.

References

ab219789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up