Overview
- Product nameAnti-1N331 antibody
- DescriptionMouse polyclonal to 1N331
- Tested applicationsWB more details
- Species reactivityReacts with: Caenorhabditis elegans
- Immunogen
Fusion protein: CMLESLIRRPFCMNPQLQTHPYDRQPTTAPRLQMMPRRDQ TQNPVIAELMSTVTRVRDRKRQRDEEAMYPRRSVGLQTDT EDVSEVLDGGTRISDMKRVR, corresponding to amino acids 28/127 of C. elegans 1N331
- General notesProduced from outbred CD1 mice
This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Properties
- FormLiquid
- Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
- Storage bufferConstituents: 50% Glycerol
- PurityWhole antiserum
- Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab22023 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB |
Not tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
Target
-
Database links
- Entrez Gene: 173144 Caenorhabditis elegans
- SwissProt: Q9XUM8 Caenorhabditis elegans
-
Alternative names
- Hypothetical protein W02A11.3 antibodyring finger protein (54.9 kD) antibody
References for Anti-1N331 antibody (ab22023)
ab22023 has not yet been referenced specifically in any publications.
