You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

350 aa isoform DKK3 protein (Tagged-His Tag) (ab91806)

Submit an Abreview Q&A (2)

Overview

  • Product name350 aa isoform DKK3 protein (Tagged-His Tag)See all Dkk3 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 33-350 (318 amino acids) of Human 350 aa isoform DKK3 with N terminal His tag, Predicted MWt 36 kDa (UniProt Q9UBP4).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 135 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEM EAEEAAAK ASSEVNLANLPPSYHNETNTDTKVGNNTIH VHREIHKITNNQTGQMVF SETVITSVGDEEGRRSHECI IDEDCGPSMYCQFASFQYTCQPCRGQRM LCTRDSECCG DQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQR GLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDR CPCASGLL CQPHSHSLVYVCKPTFVGSRDQDGEILLPR EVPDEYEVGSFMEEVRQE LEDLERSLTEEMALREPAAA AAALLGGEEI
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91806 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Dickkopf 3Dickkopf 3 homolog (Xenopus laevis)Dickkopf homolog 3
        Dickkopf related protein 3Dickkopf related protein 3 PrecursorDickkopf-3Dickkopf-related protein 3Dickkopf3DKK 3Dkk-3DKK3DKK3_HUMANhDkk 3hDkk-3hDkk3Regulated in gliomaREICRIGRIG-like 5-6RIG-like 7-1
      see all
  • FunctionAntagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificityHighest expression in heart, brain, and spinal cord.
  • Sequence similaritiesBelongs to the dickkopf family.
  • DomainThe C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Post-translational
    modifications    N- and O-glycosylated.
  • Cellular localizationSecreted.

    • Target information above from: UniProt accession Q9UBP4 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    350 aa isoform DKK3 protein (Tagged-His Tag) images

    • SDS-PAGE - 350 aa isoform DKK3 protein (Tagged-His Tag) (ab91806)
      SDS-PAGE - 350 aa isoform DKK3 protein (Tagged-His Tag) (ab91806)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for 350 aa isoform DKK3 protein (Tagged-His Tag) (ab91806)

    ab91806 has not yet been referenced specifically in any publications.

    Publishing research using ab91806 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91806 Submit a Question for ab91806

    Displaying 1 - 2 of 2 results for Abreviews and Q&A

    10
    Votes: Highest First

    I am interested in one of your products: His-tagged DKK3 # ab91806 and I have several Qs about it: 1. What's the main purpose of his product generated for? Do you have any data showing that this product is active and functional? We have a project focused ...

    Read More

    Thank you for your inquiry. This protein is made to work in mass spec and to be run as a positive control in SDS-PAGE. We do not have any data to suggest that this protin is active and we believe it will not have activity since it was purified under dena...

    Read More

    I am interested in one of your products: His-tagged DKK3 # ab91806 and I have several Qs about it: 1. What's the main purpose of his product generated for? Do you have any data showing that this product is active and functional? We are looking for a comme...

    Read More

    Thank you for contacting us. To answer your questions: 1) The protein has been tested in mass spectrometry as well as SDS-PAGE and could be used as positive control in such experiments. Functional studies have not been performed with this product and the...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"