Overview

  • Product nameAnti-5HT3E antibody
    See all 5HT3E primary antibodies
  • Description
    Rabbit polyclonal to 5HT3E
  • Tested applicationsSuitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 360-409 of Human 5HT3E;

    RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG

    (NP_872395)

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceHTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.
  • Cellular localizationCell membrane; Multi-pass membrane protein. Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
  • Database links
  • Alternative names
    • 5-HT-3 antibody
    • 5-HT3 receptor subunit E splice variant HTR3Ea antibody
    • 5-HT3c1 antibody
    • 5-HT3E antibody
    • 5-HT3R antibody
    • 5-hydroxytryptamine (serotonin) receptor 3, family member E antibody
    • 5-hydroxytryptamine receptor 3 subunit E antibody
    • 5-hydroxytryptamine receptor 3E antibody
    • 5HT3c1 antibody
    • 5HT3E antibody
    • 5HT3R antibody
    • HTR3 antibody
    • MGC120035 antibody
    • MGC120036 antibody
    • MGC120037 antibody
    • SEROTONIN 5-HT-3E RECEPTOR antibody
    • serotonin receptor 3 subunit E antibody
    • Serotonin receptor 3E antibody
    see all

Anti-5HT3E antibody images

  • Immunofluorescence of Mouse spinal cord using ab85596 used at 1.3ug/mL
  • Anti-5HT3E antibody (ab85596) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal heart lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 51 kDa
    Observed band size : 53 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 39 kDa,<22 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration: 12%

References for Anti-5HT3E antibody (ab85596)

ab85596 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"