You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

67kDa Laminin Receptor protein (ab114294)

Submit an Abreview Q&A (1)

Overview

  • Product name67kDa Laminin Receptor proteinSee all 67kDa Laminin Receptor proteins and peptides ...
  • Protein descriptionRecombinant full length protein, corresponding to amino acids 1-295 of Human 67kDa Laminin Receptor, with an N-terminal proprietary tag, 33kDa inclusive of tag (SwissProt ID P08865).
  • Uniprot accessionP08865
  • Molecular weight58.560kDa inclusive of tags
  • Protein length295 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Sequence notesMSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYK RKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSR NTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPR LLVVTDPRAGHQPLTEASYVNLPTIALCNTDSPLRYVDIA IPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA TQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP TAQATEWVGATTDWS
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114294 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    WB WB: Use at an assay dependent concentration.
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
  • Application notesThis peptide can be used with studies using ab99484,ab110499 and ab137388.

    • Protein info

    • Alternative names
        34/67 kDa laminin receptor37 kDa laminin receptor precursor37/67 kDa laminin receptor
        37LRP40S ribosomal protein SA67 kDa laminin receptor67LRColon carcinoma laminin binding proteinColon carcinoma laminin-binding proteinLAMBRLaminin receptor 1Laminin-binding protein precursor p40LamRLAMR 1LAMR1LBPLBP/p40LRPLRP/LRMultidrug resistance associated protein MGr1 AgMultidrug resistance associated protein MGr1AgMultidrug resistance-associated protein MGr1-AgNEM/1CHD4p40Ribosomal Protein SArpsARSSA_HUMANSA
      see all
  • FunctionRequired for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria.
  • Sequence similaritiesBelongs to the ribosomal protein S2P family.
  • Post-translational
    modifications    Acylated. Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association.
    Cleaved by stromelysin-3 (ST3) at the cell surface. Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions.
  • Cellular localizationCell membrane. Cytoplasm. Nucleus. 67LR is found at the surface of the plasma membrane, with its C-terminal laminin-binding domain accessible to extracellular ligands. 37LRP is found at the cell surface, in the cytoplasm and in the nucleus (By similarity). Co-localizes with PPP1R16B in the cell membrane.

    • Target information above from: UniProt accession P08865 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    67kDa Laminin Receptor protein images

    • SDS-PAGE - 67kDa Laminin Receptor protein (ab114294)
      SDS-PAGE - 67kDa Laminin Receptor protein (ab114294)
      12.5% SDS-PAGE image showing ab114294 at approx 58.56kDa. Stained with Coomassie Blue.

    References for 67kDa Laminin Receptor protein (ab114294)

    ab114294 has not yet been referenced specifically in any publications.

    Publishing research using ab114294 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114294 Submit a Question for ab114294

    Displaying 1 - 1 of 1 results for Abreviews and Q&A

    10
    Votes: Highest First

    I would like to know if the 67kDa Laminin Receptor protein (ab114294) is active. I need to have the receptor conformation to bind a protein that the laminin receptor recognizes on the cell surface.

    Unfortunately, we haven’t tested if ab114294 is active nor the receptor conformation to bind a protein that the laminin receptor recognises on the cell surface.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"