Overview

  • Product name
  • Description
    Rabbit polyclonal to A RAF
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human A RAF aa 228-299.
    Sequence:

    DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAE QRERKSLADDKKKVKNLGYRDS


    Database link: P10398

  • Positive control
    • RT-4 cell line lysate; HEK293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 68 kDa.

Target

  • Function
    Involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
  • Tissue specificity
    Predominantly in urogenital tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 RBD (Ras-binding) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • A raf 1 antibody
    • A Raf proto oncogene serine/threonine protein kinase antibody
    • ARAF 1 antibody
    • Araf antibody
    • ARaf proto oncogene serine/threonine protein kinase antibody
    • ARAF_HUMAN antibody
    • ARAF1 antibody
    • Oncogene Araf1 antibody
    • Oncogene PKS2 antibody
    • PKS 2 antibody
    • PKS antibody
    • PKS2 antibody
    • Proto oncogene Pks antibody
    • Proto-oncogene A-Raf antibody
    • Proto-oncogene A-Raf-1 antibody
    • Proto-oncogene Pks antibody
    • RAFA 1 antibody
    • RAFA1 antibody
    • Ras binding protein DA Raf antibody
    • Serine/threonine-protein kinase A-Raf antibody
    • v raf murine sarcoma 3611 viral oncogene homolog antibody
    • v raf murine sarcoma 3611 viral oncogene homolog 1 antibody
    • v raf oncogene homolog 1 (murine sarcoma 3611 virus) antibody
    see all

Anti-A RAF antibody images

  • Anti-A RAF antibody (ab220343) at 1/100 dilution + RT-4 cell line lysate

    Predicted band size : 68 kDa
  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized HEK293 cells labeling A RAF with ab220343 at 4 μg/ml dilution (green).

References for Anti-A RAF antibody (ab220343)

ab220343 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab220343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up