Overview

  • Product name
  • Description
    Rabbit polyclonal to A RAF
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human A RAF aa 228-299.
    Sequence:

    DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAE QRERKSLADDKKKVKNLGYRDS


    Database link: P10398

  • Positive control
    • RT-4 cell line lysate; HEK293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 68 kDa.

Target

  • Function
    Involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
  • Tissue specificity
    Predominantly in urogenital tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 RBD (Ras-binding) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • A raf 1 antibody
    • A Raf proto oncogene serine/threonine protein kinase antibody
    • ARAF 1 antibody
    • Araf antibody
    • ARaf proto oncogene serine/threonine protein kinase antibody
    • ARAF_HUMAN antibody
    • ARAF1 antibody
    • Oncogene Araf1 antibody
    • Oncogene PKS2 antibody
    • PKS 2 antibody
    • PKS antibody
    • PKS2 antibody
    • Proto oncogene Pks antibody
    • Proto-oncogene A-Raf antibody
    • Proto-oncogene A-Raf-1 antibody
    • Proto-oncogene Pks antibody
    • RAFA 1 antibody
    • RAFA1 antibody
    • Ras binding protein DA Raf antibody
    • Serine/threonine-protein kinase A-Raf antibody
    • v raf murine sarcoma 3611 viral oncogene homolog antibody
    • v raf murine sarcoma 3611 viral oncogene homolog 1 antibody
    • v raf oncogene homolog 1 (murine sarcoma 3611 virus) antibody
    see all

Images

  • Anti-A RAF antibody (ab220343) at 1/100 dilution + RT-4 cell line lysate

    Predicted band size : 68 kDa
  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized HEK293 cells labeling A RAF with ab220343 at 4 μg/ml dilution (green).

References

ab220343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up