Overview

  • Product name
  • Description
    Rabbit polyclonal to AACS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Zebrafish, Cynomolgus monkey, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human AACS aa 155-239.
    Sequence:

    RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLI FSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI


    Database link: Q86V21

  • Positive control
    • Human kidney tissue, MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunofluorescent analysis of paraformaldehyde fixed, Triton X-100 permeabilized MCF7 cells labeling AACS with ab204607 at 4µg/ml (green).

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling AACS with ab204607 at 1/50.

References

ab204607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up