Overview

  • Product name
  • Description
    Rabbit polyclonal to AASS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human AASS aa 33-455. (Expressed in E.coli).
    Sequence:

    VNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQED ISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIR LIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHI GMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQ AIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPA EYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLA PGKFSPAGVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYD ADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSD ATQPLESQNFSPVVRDAVITSNGTL


    Database link: Q9UDR5

  • Positive control
    • WB: Human lung tissue; Recombinant human AASS protein. IHC-P: Human prostate, glioma, kidney, stomach, breast cancer and cerebrum tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 102 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-AASS antibody (ab231710) at 1 µg/ml + Recombinant human AASS protein

    Predicted band size: 102 kDa

  • Anti-AASS antibody (ab231710) at 1 µg/ml + Human lung tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 102 kDa

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for AASS using ab231710 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up