Overview

  • Product name
  • Description
    Rabbit polyclonal to AATK
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human AATK aa 1216-1374 (C terminal). (Expressed in E.coli).
    Sequence:

    LLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAKESPPT FLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAM ALDPAAPAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEA GAGGESKEA


    Database link: Q6ZMQ8

  • Positive control
    • WB: Recombinant human AATK protein; Mouse, rat and pig brain lysates. IHC-P: Human kidney, liver, stomach cancer, prostate gland and pancreatic cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 145 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    May be involved in neuronal differentiation.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated by CDK5.
  • Cellular localization
    Membrane. Cytoplasm. Cytoplasm > perinuclear region. Predominantly perinuclear.
  • Information by UniProt
  • Database links
  • Alternative names
    • AATK antibody
    • AATYK antibody
    • AATYK1 antibody
    • Apoptosis associated tyrosine kinase antibody
    • Apoptosis-associated tyrosine kinase antibody
    • Brain apoptosis associated tyrosine kinase antibody
    • Brain apoptosis-associated tyrosine kinase antibody
    • CDK5 binding protein antibody
    • CDK5-binding protein antibody
    • KIAA0641 antibody
    • Lemur tyrosine kinase 1 antibody
    • LMR1 antibody
    • LMTK1 antibody
    • LMTK1_HUMAN antibody
    • p35 binding protein antibody
    • p35-binding protein antibody
    • p35BP antibody
    • Serine/threonine protein kinase LMTK1 antibody
    • Serine/threonine-protein kinase LMTK1 antibody
    see all

Images

  • Paraffin-embedded human pancreatic cancer tissue stained for AATK using ab231529 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate gland tissue stained for AATK using ab231529 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for AATK using ab231529 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for AATK using ab231529 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for AATK using ab231529 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-AATK antibody (ab231529) at 3 µg/ml

    Lane 1 : Mouse brain lysate
    Lane 2 : Rat brain lysate
    Lane 3 : Pig brain lysate

    Secondary
    All lanes : HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 145 kDa

  • Anti-AATK antibody (ab231529) at 3 µg/ml + Recombinant human AATK protein.

    Secondary
    HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 145 kDa

References

ab231529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up