You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameABCA4 proteinSee all ABCA4 proteins and peptides ...
  • Protein descriptionRecombinant fragment corresponding to amino acids 2174-2273 of Human ABCA4 with an N terminal proprietary tag; Predicted MWt 36.63 kDa (UniProt P78363).
  • Uniprot accessionP78363
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • SequencePKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSS SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQT ESHDLPLHPRAAGASRQAQD
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114660 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    WB WB: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    ELISA ELISA: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        ABC 10ABC A4ABC10
        ABCA 4abcA4ABCA4_HUMANABCRARMD 2ARMD2ATP binding cassette 10ATP binding cassette sub family A member 4ATP binding cassette sub family A member4ATP binding cassette transporterATP binding cassette transporter retinal specificATP binding cassette, sub family A (ABC1), member 4ATP binding cassette, sub family A (ABC1), member4ATP binding cassette10ATP binding transporter, retina specificATP-binding cassette sub-family A member 4CORD 3CORD3DKFZp781N1972FFMFLJ17534Photoreceptor rim proteinRetina specific ABC transporterRetinal specific ATP binding cassette transporterRetinal-specific ATP-binding cassette transporterRIM ABC transporterRIM proteinRmPRP 19RP19Stargardt disease proteinSTGDSTGD1
      see all
  • FunctionIn the visual cycle, acts as an inward-directed retinoid flipase, retinoid substrates imported by ABCA4 from the extracellular or intradiscal (rod) membrane surfaces to the cytoplasmic membrane surface are all-trans-retinaldehyde (ATR) and N-retinyl-phosphatidyl-ethanolamine (NR-PE). Once transported to the cytoplasmic surface, ATR is reduced to vitamin A by trans-retinol dehydrogenase (tRDH) and then transferred to the retinal pigment epithelium (RPE) where it is converted to 11-cis-retinal. May play a role in photoresponse, removing ATR/NR-PE from the extracellular photoreceptor surfaces during bleach recovery.
  • Tissue specificityRetinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells.
  • Involvement in diseaseDefects in ABCA4 are the cause of Stargardt disease type 1 (STGD1) [MIM:248200]. STGD is one of the most frequent causes of macular degeneration in childhood. It is characterized by macular dystrophy with juvenile-onset, rapidly progressive course, alterations of the peripheral retina, and subretinal deposition of lipofuscin-like material. STGD1 inheritance is autosomal recessive.
    Defects in ABCA4 are the cause of fundus flavimaculatus (FFM) [MIM:248200]. FFM is an autosomal recessive retinal disorder very similar to Stargardt disease. In contrast to Stargardt disease, FFM is characterized by later onset and slowly progressive course.
    Defects in ABCA4 may be a cause of age-related macular degeneration type 2 (ARMD2) [MIM:153800]. ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid (known as drusen) that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
    Defects in ABCA4 are the cause of cone-rod dystrophy type 3 (CORD3) [MIM:604116]. CORDs are inherited retinal dystrophies belonging to the group of pigmentary retinopathies. CORDs are characterized by retinal pigment deposits visible on fundus examination, predominantly in the macular region, and initial loss of cone photoreceptors followed by rod degeneration. This leads to decreased visual acuity and sensitivity in the central visual field, followed by loss of peripheral vision. Severe loss of vision occurs earlier than in retinitis pigmentosa.
    Defects in ABCA4 are the cause of retinitis pigmentosa type 19 (RP19) [MIM:601718]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP19 is characterized by choroidal atrophy. Inheritance is autosomal recessive.
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCA family.
    Contains 2 ABC transporter domains.
  • Cellular localizationMembrane. Localized to outer segment disk edges of rods and cones, with around one million copies/photoreceptor.

    • Target information above from: UniProt accession P78363 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    ABCA4 protein images

    • SDS-PAGE - ABCA4 protein (ab114660)
      SDS-PAGE - ABCA4 protein (ab114660)
      SDS-PAGE analysis of ab114660 on a 12.5% gel stained with Coomassie Blue.

    References for ABCA4 protein (ab114660)

    ab114660 has not yet been referenced specifically in any publications.

    Publishing research using ab114660 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114660 Submit a Question for ab114660

    There are currently no Abreviews or Questions for ab114660.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"