Overview

  • Product name
  • Description
    Rabbit polyclonal to ABCA6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ABCA6 aa 788-848.
    Sequence:

    LEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVSDMGLWRMQV FAMARLRFLKL


    Database link: Q8N139

  • Positive control
    • ICC/IF: RT4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Probable transporter which may play a role in macrophage lipid homeostasis.
  • Tissue specificity
    Widely expressed with higher expression in liver.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCA family.
    Contains 2 ABC transporter domains.
  • Developmental stage
    Expressed in fetal kidney, lung and liver.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ABC transporter ABCA6 antibody
    • ABCA 6 antibody
    • ABCA6 antibody
    • ABCA6_HUMAN antibody
    • ATP binding cassette A6 antibody
    • ATP binding cassette sub family A (ABC1) member 6 antibody
    • ATP binding cassette sub family A member 6 antibody
    • ATP-binding cassette sub-family A member 6 antibody
    • EST155051 antibody
    • FLJ43498 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for ABCA6 (green) using ab221712 at 4 µg/ml in ICC/IF.

References

ab221712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up