Overview

  • Product name
    Anti-ACAA1 antibody [CL2650]
    See all ACAA1 primary antibodies
  • Description
    Mouse monoclonal [CL2650] to ACAA1
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human ACAA1 aa 72-199.
    Sequence:

    VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNR QCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEK EKARDCLIPMGITSENVAERFGISREKQ


    Database link: P09110

  • Epitope
    Binds to an epitope located within the peptide sequence GAIMARIAQFLSDIP as determined by overlapping synthetic peptides.
  • Positive control
    • U251 cells; Human colon, Human liver, Human kidney and Human prostate tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab210961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 44 kDa.

Target

Images

  • Anti-ACAA1 antibody [CL2650] (ab210961) at 1/500 dilution + U251 cells

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue labeling ACAA1 with ab210961 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue labeling ACAA1 with ab210961 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human liver tissue labeling ACAA1 with ab210961 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon tissue labeling ACAA1 with ab210961 at 1/200 dilution.

References

ab210961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up