Overview

  • Product name
  • Description
    Rabbit polyclonal to ACAT2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human ACAT2 aa 150-200 (internal sequence). The exact sequence is proprietary.
    Sequence:

    GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFD K


    Database link: Q9BWD1

  • Positive control
    • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab187712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 41 kDa.

Target

Images

  • All lanes : Anti-ACAT2 antibody (ab187712) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : Mouse TCMK-1 whole cell lysate
    Lane 5 : Mouse NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 41 kDa


    Exposure time: 3 minutes

References

ab187712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Duodenum)
Gel Running Conditions
Reduced Denaturing (12.5%)
Loading amount
30 µg
Specification
Duodenum
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted May 04 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up