Overview

  • Product name
  • Description
    Rabbit polyclonal to ACP6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse ACP6 aa 1-418. (Expressed in E.coli).
    Sequence:

    MRVWVPVGVLTSLAYCFHQRRVALAEQRAPNGQRPVDRNLLELKMVQVVF RHGARSPLKPLPLEEQVEWNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYD TEYRKTTLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQ EVFIRSTNMFRNLESTRCLLAGLFQHQKGSAVIHTDEASSEVLYPNYQSC WVLKEKTRGRKKAAISQPGISEDLEKVKTGVGINNGDDVDFFVLLDNVAA EQVHSLLNCPALERFAQLIEQRAVDMALYVVEQEDRESIQMAVGPFLHIL EGNLLKTVDPTTAPSKTRKMYLYATHDVTLLPMLLALGIFDQKWPPFAVD LTMELYQHQESKEWFVQLFYNGKEQVPRGCPDKLCPLDKFLNTMSVYSVS PEKYRTLCSKTRIVELGE


    Database link: Q8BP40

  • Positive control
    • WB: K562 and MCF7 cell lysates; Mouse liver lysate; Recombinant mouse ACP6 protein. IHC-P: Mouse liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Hydrolyzes lysophosphatidic acid to monoacylglycerol.
  • Tissue specificity
    Highly expressed in kidney, heart, small intestine, muscle, liver, prostate, testis, ovary and weakly expressed in thymus and colon.
  • Sequence similarities
    Belongs to the histidine acid phosphatase family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Acid phosphatase 6 antibody
    • Acid phosphatase 6, lysophosphatidic antibody
    • Acid phosphatase like 1 antibody
    • Acid phosphatase like protein 1 antibody
    • Acid phosphatase-like protein 1 antibody
    • ACP6 antibody
    • ACPL1 antibody
    • LPAP antibody
    • Lysophosphatidic acid phosphatase 6 antibody
    • Lysophosphatidic acid phosphatase type 6 antibody
    • Lysophosphatidic acid phosphatase type 6 precursor antibody
    • lysophosphatidic antibody
    • PACPL1 antibody
    • PPA6_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for ACP6 using ab232776 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ACP6 antibody (ab232776) at 1 µg/ml + Mouse liver lysate

    Predicted band size: 48 kDa

  • Anti-ACP6 antibody (ab232776) at 1 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 48 kDa

  • Anti-ACP6 antibody (ab232776) at 1 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Predicted band size: 48 kDa

  • Anti-ACP6 antibody (ab232776) at 2 µg/ml + Recombinant mouse ACP6 protein

    Predicted band size: 48 kDa

References

ab232776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up