You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameACSL1 protein (Tagged)See all ACSL1 proteins and peptides ...
  • Protein descriptionRecombinant fragment: PKPLKPPCDL SMQSVEVAGS GGARRSALLD SDEPLVYFYD DVTTLYEGFQ RGIQVSNNGP CLGSRKPDQP YEWLSYKQVA ELSECIGSAL IQKGFKTA of Human ACSL1 (amino acids 48-145) with N terminal proprietary tag, 36.41 kDa (NP_001986).
  • Uniprot accessionP33121
  • Molecular weight36.410kDa inclusive of tags
  • Protein length98 amino acids
  • Expression hostWheat germ

    • Properties

  • E.C. Number6.2.1.3
  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • SequencePKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYD DVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVA ELSECIGSALIQKGFKTA
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab116839 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration. (Recombinant protein).

    Protein info

    • Alternative names
        ACS 1ACS1ACSL 1
        ACSL1Acyl CoA synthetase 1Acyl CoA synthetase long chain family member 1FACL 1FACL 2FACL1FACL2Fatty acid Coenzyme A ligase long chain 1Fatty acid Coenzyme A ligase long chain 2LACSLACS 1LACS 2LACS1LACS2Lignoceroyl CoA synthaseLong chain acyl CoA synthetase 1Long chain acyl CoA synthetase 2Long chain fatty acid CoA ligase 1Long chain fatty acid CoA ligase 2Long chain fatty acid coenzyme A ligase 1Long-chain acyl-CoA synthetase 2Palmitoyl CoA ligase 1Palmitoyl CoA ligase 2
      see all
  • FunctionActivation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
  • Tissue specificityHighly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
  • Sequence similaritiesBelongs to the ATP-dependent AMP-binding enzyme family.
  • Developmental stageExpressed during the early stages of erythroid development while expression is very low in reticulocytes and young erythrocytes.
  • Cellular localizationMitochondrion outer membrane. Peroxisome membrane. Microsome membrane. Endoplasmic reticulum membrane.

    • Target information above from: UniProt accession P33121 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    ACSL1 protein (Tagged) images

    • SDS-PAGE - ACSL1 protein (Tagged) (ab116839)
      SDS-PAGE - ACSL1 protein (Tagged) (ab116839)
      12.5% SDS-PAGE stained with Coomassie Blue showing ab116839 at approximately 36.41 kDa.

    References for ACSL1 protein (Tagged) (ab116839)

    ab116839 has not yet been referenced specifically in any publications.

    Publishing research using ab116839 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab116839 Submit a Question for ab116839

    There are currently no Abreviews or Questions for ab116839.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"