Overview

  • Product name
  • Description
    Rabbit polyclonal to ADA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human ADA aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLAN S


    Database link: P00813

  • Positive control
    • Mouse embryo tissue. Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab217846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/500. Predicted molecular weight: 41 kDa.

Target

  • Function
    Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion.
  • Tissue specificity
    Found in all tissues, occurs in large amounts in T-lymphocytes and, at the time of weaning, in gastrointestinal tissues.
  • Involvement in disease
    Defects in ADA are the cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-negative/NK-cell-negative due to adenosine deaminase deficiency (ADASCID) [MIM:102700]. SCID refers to a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients with SCID present in infancy with recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. ADA-SCID is an autosomal recessive form accounting for about 50% of non-X-linked SCIDs. ADA deficiency has been diagnosed in chronically ill teenagers and adults (late or adult onset). Population and newborn screening programs have also identified several healthy individuals with normal immunity who have partial ADA deficiency.
  • Sequence similarities
    Belongs to the adenosine and AMP deaminases family.
  • Cellular localization
    Cell membrane. Cell junction. Cytoplasmic vesicle lumen. Cytoplasm. Colocalized with DPP4 at the cell junction in lymphocyte-epithelial cell adhesion.
  • Information by UniProt
  • Database links
  • Alternative names
    • ada antibody
    • ADA_HUMAN antibody
    • ADA1 antibody
    • Adenosine aminohydrolase antibody
    • Adenosine deaminase antibody
    see all

Images

  • Anti-ADA antibody (ab217846) at 1/300 dilution + mouse spleen lysate

    Secondary
    goat anti-rabbit IgG antibody (H+L) HRP-conjugated at 1/5000 dilution

    Developed using the ECL technique.

    Predicted band size: 41 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse embryo tissue, labeling ADA using ab217846 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up