Anti-ADAR1 antibody (ab16138)
Key features and details
- Sheep polyclonal to ADAR1
- Suitable for: WB
- Reacts with: Rat
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-ADAR1 antibody
See all ADAR1 primary antibodies -
Description
Sheep polyclonal to ADAR1 -
Host species
Sheep -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Human -
Immunogen
Fusion protein: SFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEK NFYLCPVPND, corresponding to amino acids 1116-1176 of Rat ADAR1. The fusion protein was constructed in the pGEX-KG vector by inserting a fragment corresponding to nucleotides +3346 through +3525 of ADAR1 at the XbaI and XhoI sites in the vector.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Purified by Ammonium sulfate precipitation. This antibody is provided as a 0.2µm sterile filtered solution. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab16138 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration.
|
Notes |
---|
WB
Use at an assay dependent concentration. |
Target
-
Function
Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression. -
Tissue specificity
Ubiquitously expressed, highest levels were found in brain and lung. -
Involvement in disease
Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet. -
Sequence similarities
Contains 1 A to I editase domain.
Contains 2 DRADA repeats.
Contains 3 DRBM (double-stranded RNA-binding) domains. -
Post-translational
modificationsSumoylation reduces RNA-editing activity. -
Cellular localization
Cytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 103 Human
- Entrez Gene: 56417 Mouse
- Entrez Gene: 81635 Rat
- Omim: 146920 Human
- SwissProt: P55265 Human
- SwissProt: Q99MU3 Mouse
- SwissProt: P55266 Rat
- Unigene: 12341 Human
see all -
Alternative names
- 136 kDa double-stranded RNA-binding protein antibody
- 136kDa double stranded RNA binding protein antibody
- Adar 1 antibody
see all
Datasheets and documents
-
Datasheet download
References (0)
ab16138 has not yet been referenced specifically in any publications.