You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

AKR1B1 protein (Active) (ab117190)

Submit an Abreview Q&A (3)

Overview

  • Product nameAKR1B1 protein (Active)See all AKR1B1 proteins and peptides ...
  • Protein descriptionRecombinant full length Human AKR1B1 (amino acids 1-316), 35.8 kDa. (UniProt P15121).
  • Uniprot accessionP15121
  • Molecular weight35.800kDa
  • Protein length316 amino acids
  • Expression hostE. coli

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Purification notesab117190 is purified by proprietary chromatographic techniques.
  • Biological activitySpecific activity : approximately 0.5 - 0.6 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • E.C. Number1.1.1.21
  • FormLiquid
  • Storage instructionsPlease see Notes sectionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferpH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol
  • Concentration information loading...
  • Additional notesStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
  • Sequence notesMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGY RHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLW CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGIS NFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab117190 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    Functional Studies FuncS: Use at an assay dependent concentration.
  • Application notesThis peptide can be used with studies using ab62795 and ab153897.

    • Protein info

    • Alternative names
        ADRAKR1B 1Akr1b1
        Aldehyde reductaseAldehyde reductase 1Aldo keto reductase family 1, member B1Aldo-keto reductase family 1 member B1aldo-keto reductase family 1, member B1 (aldose reductase)Aldose reductasealdr 1ALDR_HUMANaldr1ALR2ARLii5 2 CTCL tumor antigenLow Km aldose reductaseMGC1804
      see all
  • FunctionCatalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
  • Tissue specificityHighly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
  • Sequence similaritiesBelongs to the aldo/keto reductase family.
  • Cellular localizationCytoplasm.

    • Target information above from: UniProt accession P15121 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    References for AKR1B1 protein (Active) (ab117190)

    ab117190 has not yet been referenced specifically in any publications.

    Publishing research using ab117190 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab117190 Submit a Question for ab117190

    Displaying 1 - 3 of 3 results for Abreviews and Q&A

    10
    Votes: Highest First

    Could you provide the raw activity QC data for lot#***

    Thank you for your reply.

    I spoke to the lab again and this time they were able to supply the raw data that you were asking for. This information is in the Excel file that is attached.

    If there is anything else I can help you with, pleas...

    Read More

    Could you provide the raw activity QC data for lot# **?

    Thank you for contacting Abcam.

    I have talked to the lab and we are unable to send you the actual raw QC data, but below is the protocol they used to test the activity of ab117190:

    Activity Assay:

    1. Prepare a 1ml reaction mix i...

    Read More

    Phone call requesting information on the activity of the AKR1B1 protein (Active) (ab117190) of the lot number GR101457-1

    Thank you for contacting us today and your interest in our products.

    I can now confirm that the specific activity figures I quoted to you over the phone did relate to the most current lot which you have received. Enzymatic activity was confirmed...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"