
  • Product nameAnti-ALKBH3 antibody
    See all ALKBH3 primary antibodies
  • Description
    Rabbit polyclonal to ALKBH3
  • Tested applicationsWBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 215-264 (EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYH S) of Human ALKBH3, NP_631917

  • Positive control
    • Fetal muscle lysate (Human)


Associated products


Our Abpromise guarantee covers the use of ab85636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionDioxygenase that repairs alkylated DNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Has a strong preference for single-stranded DNA. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificityUbiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
  • Sequence similaritiesBelongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1700108H04Rik antibody
    • 1810020C19Rik antibody
    • ABH3 antibody
    • AlkB homolog 3 antibody
    • alkB, alkylation repair homolog 3 (E. coli) antibody
    • ALKB3_HUMAN antibody
    • ALKBH3 antibody
    • Alkylated DNA repair protein alkB homolog 3 antibody
    • alkylation repair homolog 3 antibody
    • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 antibody
    • DEPC 1 antibody
    • DEPC-1 antibody
    • DEPC1 antibody
    • EC 1.14.11. antibody
    • FLJ43614 antibody
    • mABH3 antibody
    • MGC118790 antibody
    • MGC118792 antibody
    • MGC118793 antibody
    • MGC134125 antibody
    • PCA1 antibody
    • Prostate cancer antigen 1 antibody
    • Prostate cancer antigen-1 antibody
    • RP23-375N21.4 antibody
    see all

Anti-ALKBH3 antibody images

  • Anti-ALKBH3 antibody (ab85636) at 1 µg/ml + Fetal muscle lysate (Human) at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 33 kDa
    Observed band size : 33 kDa
    Additional bands at : 40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ALKBH3 antibody (ab85636)

ab85636 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85636.
Please use the links above to contact us or submit feedback about this product.