You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-AP2 alpha antibody [AP2a 8G8/5] (ab18112)

CodeSizePriceAbpointsAvailability
    
 
  • -

  •   
  •   
  •   
  •  

  •  
  •  
  •  

  •  
Updating...

Reassurance, Refunds & Replacements

If your product does not perform as described on this datasheet, we will refund or replace your product...

Read our guarantee »

This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab18112 for help.

Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.

3 questions for ab18112

first page       

Page 1 of 1

     last page  

Question 1

Friday 07-April-2006

Do you have a recommendation for a positive control tissue for this antibody?

ANSWER:

 

Thank you for your enquiry.

Raji cells or breast carcinoma can be used as a positive control for this antibody.

I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Question 2

Friday 17-June-2005

What is the epitope? Is it N- or C-terminal?

ANSWER:

 

Thank you for your enquiry. I received the following information from the source of this antibody - we "don't know the precise epitope recognized by 8G8, but due to the antigen used to raise this antibody, it must lie within the sequence: aa165 GINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSS

i.e. this is a stretch of 58 amino acids starting at aa 165 in the human AP-2alpha sequence and corresponds to a region just N-terminal of the DNA binding domain so is neither N- or C-terminal really but right in the middle of the protein!"

If you have any additional questions, please contact us again.

Question 3

Friday 10-June-2005

What is the homology between mouse and human?

ANSWER:

 

Thank you for your enquiry.

All the information we have on species cross reactivity is specified on the datasheet, these are updated as soon as any new information is brought to our attention.

As far as we are aware, cross reactivity with mouse has not yet been tested for use with ab18112. However, there is very high homology between the human and mouse sequences. In fact, 432 of 437 amino acids are identical and the 5 differences are conservative changes. I would definitely expect this antibody to cross-react with mouse. Should you decide to go ahead and purchase this product, please let us know how you get on and in return we will reward you with 50 Abcam points that can be redeemed for a variety of items such as Amazon gift certificates, Starbucks gift cards, etc.

Please let me know if you require any further assistance.

first page       

Page 1 of 1

     last page  

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"