You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

AP2 alpha protein (Tagged-His Tag) (ab91893)

Submit an Abreview Submit a Question

Overview

  • Product nameAP2 alpha protein (Tagged-His Tag)
  • Protein descriptionRecombinant fragment, corresponding to amino acids 734-950 (217 aa) of Human AP2 alpha isoform B, with a N terminal His tag; predicted MWt 25kDa: Uniprot ID = O95782.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitution with 45 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesFENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTV VHPGDLQTQLAVQT KRVAAQVDGGAQVQQVLNIECLRD FLTPPLLSVRFRYGGAPQALTLKLPVTINK FFQPTEMA AQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGF GSALLD NVDPNPENFVGAGIIQTKALQVGCLLRLEPNA QAQMYRLTLRTSKEPVSRHLCEL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91893 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        100 kDa coated vesicle protein AAdapter-related protein complex 2 alpha-1 subunitAdaptin alpha
        Adaptin alpha AAdaptor protein complex AP 2 alpha 1 subunitadaptor protein complex AP 2 subunit alpha 1Adaptor protein complex AP-2 subunit alpha-1Adaptor protein complex AP2 alpha 1 subunitadaptor protein complex AP2 subunit alpha 1Adaptor related protein complex 2 alpha 1 subunitAdaptor related protein complex AP 2 alpha 1 subunitAdaptor related protein complex AP2 alpha 1 subunitADTAAAlpha A adaptinAlpha adaptin AAlpha-adaptin Aalpha1 adaptinAlpha1-adaptinAP 2 alphaAP 2 complex subunit alpha 1AP-2 complex subunit alpha-1AP2 complex subunit alpha 1AP2-ALPHAAp2a1AP2A1_HUMANCLAPA 1CLAPA1Clathrin adaptor complex AP2. alpha subunitClathrin assembly protein complex 2 alpha A large chainClathrin assembly protein complex 2 alpha-A large chainClathrin associated / assembly / adaptor protein large alpha 1clathrin associated assembly adaptor protein large alpha 1clathrin associated/assembly/adaptor protein, large, alpha 1Plasma membrane adaptor HA 2/AP 2 adaptin alpha A subunitPlasma membrane adaptor HA2/AP2 adaptin alpha A subunit
      see all
  • FunctionComponent of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha subunit binds polyphosphoinositide-containing lipids, positioning AP-2 on the membrane. The AP-2 alpha subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif.
  • Tissue specificityIsoform A expressed in forebrain, skeletal muscle, spinal cord, cerebellum, salivary gland, heart and colon. Isoform B is widely expressed in tissues and also in breast cancer and in prostate carcinoma cells.
  • Sequence similaritiesBelongs to the adaptor complexes large subunit family.
  • Cellular localizationCell membrane. Membrane > coated pit. AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV.

    • Target information above from: UniProt accession O95782 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    AP2 alpha protein (Tagged-His Tag) images

    • SDS-PAGE - AP2 alpha protein (Tagged-His Tag) (ab91893)
      SDS-PAGE - AP2 alpha protein (Tagged-His Tag) (ab91893)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for AP2 alpha protein (Tagged-His Tag) (ab91893)

    ab91893 has not yet been referenced specifically in any publications.

    Publishing research using ab91893 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91893 Submit a Question for ab91893

    There are currently no Abreviews or Questions for ab91893.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"