You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameATF6 beta protein
  • Protein descriptionRecombinant fragment, corresponding to amino acids 2-88 of Human ATF6 beta, with an N-terminal proprietary tag, predicted MWt 35.2 kDa (UniProt ID Q99941)
  • Uniprot accessionQ99941
  • Molecular weight35.200kDa inclusive of tags
  • Protein length87 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • SequenceAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEV AEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPI FPDLQVK
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114637 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    WB WB: Use at an assay dependent concentration.
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        Activating transcription factor 6 betaActivating transcription factor 6 betaATF 6 beta
        ATF6-betaATF6BATF6B_HUMANATF6betacAMP response element binding protein related proteincAMP response element-binding protein-related proteincAMP responsive element binding protein like 1cAMP-dependent transcription factor ATF-6 betacAMP-responsive element-binding protein-like 1CREB L1Creb related proteinCREB RPCreb-rpCREBL 1CREBL1CrebrpCyclic AMP dependent transcription factor ATF 6 betaCyclic AMP dependent transcription factor ATF6 betaFLJ10066G13G13 proteinOTTHUMP00000029432OTTHUMP00000029433Processed cyclic AMP-dependent transcription factor ATF-6 betaProtein G13
      see all
  • FunctionTranscriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN(9)CCAC[GA]-3') when NF-Y is bound to ERSE.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • DomainThe basic domain functions as a nuclear localization signal.
    The basic leucine-zipper domain is sufficient for association with the NF-Y trimer and binding to ERSE.
  • Post-translational
    modifications    N-glycosylated.
    During unfolded protein response an approximative 60 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage is probably performed sequentially by site-1 and site-2 proteases.
  • Cellular localizationEndoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.

    • Target information above from: UniProt accession Q99941 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    ATF6 beta protein images

    • SDS-PAGE - ATF6 beta protein (ab114637)
      SDS-PAGE - ATF6 beta protein (ab114637)
      12.5% SDS-PAGE image showing ab114637 Stained with Coomassie Blue.

    References for ATF6 beta protein (ab114637)

    ab114637 has not yet been referenced specifically in any publications.

    Publishing research using ab114637 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114637 Submit a Question for ab114637

    There are currently no Abreviews or Questions for ab114637.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"