Anti-ATM antibody (ab17995)
Key features and details
- Rabbit polyclonal to ATM
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-ATM antibody
See all ATM primary antibodies -
Description
Rabbit polyclonal to ATM -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Synthetic peptide:
MDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRT E
, corresponding to amino acids 2550-2600 of Human ATM. -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituents: 0.021% PBS, 1.764% Sodium citrate, 1.815% Tris -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antibody was affinity purified using an epitope specific to ATM immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab17995 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (4) |
1/5000 - 1/25000. Detects a band of approximately 350 kDa (predicted molecular weight: 350 kDa).
|
IHC-P |
1/500 - 1/2000. Do not perform antigen retrieval.
|
Notes |
---|
WB
1/5000 - 1/25000. Detects a band of approximately 350 kDa (predicted molecular weight: 350 kDa). |
IHC-P
1/500 - 1/2000. Do not perform antigen retrieval. |
Target
-
Function
Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by the B-cell antigen receptor (BCR) expressed on individual B lymphocytes. After the introduction of DNA breaks by the RAG complex on one immunoglobulin allele, acts by mediating a repositioning of the second allele to pericentromeric heterochromatin, preventing accessibility to the RAG complex and recombination of the second allele. Also involved in signal transduction and cell cycle control. May function as a tumor suppressor. Necessary for activation of ABL1 and SAPK. Phosphorylates p53/TP53, FANCD2, NFKBIA, BRCA1, CTIP, nibrin (NBN), TERF1, RAD9 and DCLRE1C. May play a role in vesicle and/or protein transport. Could play a role in T-cell development, gonad and neurological function. Plays a role in replication-dependent histone mRNA degradation. Binds DNA ends. -
Tissue specificity
Found in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, spleen, thymus, testis, ovary, small intestine, colon and leukocytes. -
Involvement in disease
Defects in ATM are the cause of ataxia telangiectasia (AT) [MIM:208900]; also known as Louis-Bar syndrome, which includes four complementation groups: A, C, D and E. This rare recessive disorder is characterized by progressive cerebellar ataxia, dilation of the blood vessels in the conjunctiva and eyeballs, immunodeficiency, growth retardation and sexual immaturity. AT patients have a strong predisposition to cancer; about 30% of patients develop tumors, particularly lymphomas and leukemias. Cells from affected individuals are highly sensitive to damage by ionizing radiation and resistant to inhibition of DNA synthesis following irradiation.
Note=Defects in ATM contribute to T-cell acute lymphoblastic leukemia (TALL) and T-prolymphocytic leukemia (TPLL). TPLL is characterized by a high white blood cell count, with a predominance of prolymphocytes, marked splenomegaly, lymphadenopathy, skin lesions and serous effusion. The clinical course is highly aggressive, with poor response to chemotherapy and short survival time. TPLL occurs both in adults as a sporadic disease and in younger AT patients.
Note=Defects in ATM contribute to B-cell non-Hodgkin lymphomas (BNHL), including mantle cell lymphoma (MCL).
Note=Defects in ATM contribute to B-cell chronic lymphocytic leukemia (BCLL). BCLL is the commonest form of leukemia in the elderly. It is characterized by the accumulation of mature CD5+ B lymphocytes, lymphadenopathy, immunodeficiency and bone marrow failure. -
Sequence similarities
Belongs to the PI3/PI4-kinase family. ATM subfamily.
Contains 1 FAT domain.
Contains 1 FATC domain.
Contains 1 PI3K/PI4K domain. -
Domain
The FATC domain is required for interaction with KAT5. -
Post-translational
modificationsPhosphorylated by NUAK1/ARK5. Autophosphorylation on Ser-367, Ser-1893, Ser-1981 correlates with DNA damage-mediated activation of the kinase.
Acetylation, on DNA damage, is required for activation of the kinase activity, dimer-monomer transition, and subsequent autophosphorylation on Ser-1981. Acetylated in vitro by KAT5/TIP60. -
Cellular localization
Nucleus. Cytoplasmic vesicle. Primarily nuclear. Found also in endocytic vesicles in association with beta-adaptin. - Information by UniProt
-
Database links
- Entrez Gene: 472 Human
- Omim: 607585 Human
- SwissProt: Q13315 Human
- Unigene: 367437 Human
-
Alternative names
- A-T mutated antibody
- A-T mutated homolog antibody
- AT mutated antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate-nodular hypertrophy tissue labelling ATM with ab17995 at 1/1000 (1µg/ml). Detection: DAB.
-
Detection of Human ATM using ab17995 by Western Blot and Immunoprecipitation. Samples: A) Whole cell lysate (50
µ g) from human L-40 (WT) or AT-59 (AT) cells. B) Whole cell lysate (1 mg) from WT cells. Antibody used at indicated concentrations for WB and at 0.5µ g/mg lysate for IP. Immunoprecipitated ATM was blotted with a monoclonal antibody to ATM. Detected by chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab17995 has been referenced in 15 publications.
- Chen Z et al. MicroRNA‑129 inhibits colorectal cancer cell proliferation, invasion and epithelial‑to‑mesenchymal transition by targeting SOX4. Oncol Rep 45:N/A (2021). PubMed: 33760159
- Liu X et al. CNDAC-Induced DNA Double-Strand Breaks Cause Aberrant Mitosis Prior to Cell Death. Mol Cancer Ther 18:2283-2295 (2019). PubMed: 31501277
- Winkler C et al. Overexpression of PP1-NIPP1 limits the capacity of cells to repair DNA double-strand breaks. J Cell Sci 131:N/A (2018). PubMed: 29898919
- Kim S et al. Regulating BRCA1 protein stability by cathepsin S-mediated ubiquitin degradation. Cell Death Differ N/A:N/A (2018). PubMed: 30006610
- Wei X et al. Hint1 expression inhibits proliferation and promotes radiosensitivity of human SGC7901 gastric cancer cells. Oncol Lett 16:2135-2142 (2018). PubMed: 30008911