Overview

  • Product nameAnti-ATP6J antibodySee all ATP6J primary antibodies ...
  • Description
    Chicken polyclonal to ATP6J
  • Tested applicationsWBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Synthetic peptide corresponding to Human ATP6J aa 1-118.
    Sequence:

    MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQ REKEFKAKEA

  • Positive control
    • Testing antigen control, Pooled pre-immune background control.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Clonality Polyclonal
  • IsotypeIgY
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab15853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 13.7 kDa.

Target

  • RelevanceThis protein is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
  • Database links
  • Alternative names
    • ATP 6G antibody
    • ATP 6J antibody
    • ATP6G antibody
    • ATP6G1 antibody
    • ATP6GL antibody
    • ATP6V1G1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) member J antibody
    • ATPase H+ transporting lysosomal 13kD V1 subunit G isoform 1 antibody
    • ATPase H+ transporting lysosomal 13kDa V1 subunit G1 antibody
    • ATPase H+ transporting lysosomal member J antibody
    • ATPase H+ transporting lysosomal subunit G isoform 1 antibody
    • DKFZp547P234 antibody
    • V ATPase G subunit 1 antibody
    • V-ATPase 13 kDa subunit 1 antibody
    • Vacuolar ATP synthase subunit G 1 antibody
    • Vacuolar ATP synthase subunit G1 antibody
    • Vacuolar ATP synthase subunit M16 antibody
    • Vacuolar H+ ATPase G1 antibody
    • Vacuolar H+ ATPase subunit G 1 antibody
    • Vacuolar proton pump G subunit 1 antibody
    • Vma 10 antibody
    • Vma10 antibody
    see all

References for Anti-ATP6J antibody (ab15853)

This product has been referenced in:
  • De Luca M  et al. RILP regulates vacuolar ATPase through interaction with the V1G1 subunit. J Cell Sci 127:2697-708 (2014). Read more (PubMed: 24762812) »
  • Miller G  et al. Asparagine endopeptidase is required for normal kidney physiology and homeostasis. FASEB J 25:1606-17 (2011). WB ; Mouse . Read more (PubMed: 21292981) »

See all 2 Publications for this product

Product Wall

Thank you for your enquiry regarding ab15853. I have checked the details and you are absolutely correct that the predicted molecular weight is 13.7 kDa and not 75 kDa. I have already corrected our on-line datasheet and updated it with the correct in...

Read More

Thank you for your enquiry. Having contacted the originator of this product it would appear that the product has only been tested in Western blotting and is only “reccommended" for use in other applications. In order to avoid further confusion I have r...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"