Recombinant dog IL-8 protein (ab200269)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant dog IL-8 protein
See all IL-8 proteins and peptides -
Biological activity
The biological activity was determined by a chemotaxis bioassay using Human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.15-0.75 ng/ml.
-
Purity
> 95 % SDS-PAGE.
ab200269 is > 95 % pure as assessed by SDS-PAGE and HPLC analyses. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Dog -
Sequence
AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP -
Predicted molecular weight
9 kDa -
Amino acids
23 to 101 -
Additional sequence information
This product is for the mature full length protein from aa 23 to 101. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab200269 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Lyophilized from a 0.2 um filtered concentrated solution in 2 × PBS.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
General Info
-
Alternative names
- (Ala-IL-8)77
- (Ser-IL-8)72
- 9E3
see all -
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsSeveral N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab200269 has not yet been referenced specifically in any publications.