Recombinant Hepatitis C Virus Core 2a protein (Tagged) (ab198063)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His-DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Hepatitis C Virus Core 2a protein (Tagged) -
Biological activity
Specific Activity: 93 pmole/min/μg
Assay conditions: Assay was done in 100 μl HCV assay buffer containing 50 mM Tris, pH7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 μM HCV substrate peptide. Reaction was monitored at room temperature for 20 min continuously at ex350/em500.
-
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Sequence
MDYKDDDDKHHHHHHGCVSIIGRLHVNGSGSITAYAQQTRGLLGAIVVSM TGRDRTEQAGEVQILSTVSQSFLGTTISGVLWTVYHGAGNKTLAGLRGPV TQMYSSAEGDLVGWPSPPGTKSLEPCKCGAVDLYLVTRNADVIPARRRGD KRGALLSPRPISTLKGSSGGPVLCPRGHVVGLFRAAVCSRGVAKSIDFIP VETLDVVTRS -
Predicted molecular weight
22 kDa including tags -
Tags
His-DDDDK tag N-Terminus -
Additional sequence information
Fusion protein of amino acids 21-32 of NS4A, linker (4 amino acids) and amino acids 3-181 of NS3.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab198063 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Additional notes
Abcam has not and does not intend to apply for the REACH Authorisation of customers’ uses of products that contain European Authorisation list (Annex XIV) substances.
It is the responsibility of our customers to check the necessity of application of REACH Authorisation, and any other relevant authorisations, for their intended uses. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.63% Tris HCl, 2.32% Sodium chloride, 0.2% Triton X-100, 0.08% Beta mercaptoethanol, 30% Glycerol (glycerin, glycerine)
100 µg/mL DDDDK peptideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Genome polyprotein
- HCV 2a
- HCV core 2a
see all -
Relevance
HCV (Hepatitis C Virus) viral core protein forms the internal viral coat that encapsidates the genomic RNA and is enveloped in a host cell-derived lipid membrane. The hepatitis C virus (HCV) core protein represents the first 177 amino acids of the viral precursor polyprotein and is cotranslationally inserted into the membrane of the endoplasmic reticulum. The N terminus of the core protein is involved in transcriptional repression. There are over 20 different subtypes of Hepatitis C Virus; the preponderance and distribution of HCV genotypes varies globally. HCV Genotype information is important because of the role it plays in predicting HCV medical treatment response and treatment duration. Sustained cure rates (sustained viral response) of 75% or better occur in people with genotypes HCV 2 and 3 in 24 weeks of treatment. Genotypes 1a and 1b, the most prevalent worldwide, have the poorest rates of response to the present treatment regimen, which is a combination of pegylated alfa interferon 2b with ribavirin. HCV core protein is among the most conserved proteins in HCV and is known to induce sensitization of cytotoxic T lymphocytes (CTL). Therefore, it is a prime candidate for a component of a potential HCV vaccine.
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab198063 has not yet been referenced specifically in any publications.