Recombinant human CD40 protein (Active) (ab155710)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: ELISA, Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human CD40 protein (Active)
See all CD40 proteins and peptides -
Biological activity
Immobilized Human CD40 Ligand, His Tag at 5 μg/mL (100 μL/well) can bind ab155710 with a linear range of 0.039-1.25 μg/mL.
-
Purity
> 95 % SDS-PAGE.
>90% as determined by SEC-HPLC. Protein A purified. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETK DLVVQQAGTNKTDVVCGPQDRLR -
Predicted molecular weight
45 kDa including tags -
Amino acids
21 to 193 -
Tags
Fc tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155710 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Measured by its binding ability in a functional ELISA. Immobilized ab155710 at 2 µg/ml (100 µl/well) can bind biotinylated Human CD40L with a linear range of 7.8 - 125 ng/ml. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C.
pH: 7.4
Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris, L-Arginine, Sodium chloride
Lyophilized from 0.22 µm filtered solution.
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- AI326936
- B cell associated molecule CD40
- B cell surface antigen CD40
see all -
Function
Receptor for TNFSF5/CD40LG. -
Tissue specificity
B-cells and in primary carcinomas. -
Involvement in disease
Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab155710 has not yet been referenced specifically in any publications.