Recombinant human CD84 protein (ab182681)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CD84 protein
See all CD84 proteins and peptides -
Biological activity
Measured in a cell proliferation assay using PHA stimulated Human T cells in the presence of anti-CD3.
The ED50 for this effect is typically 2-6 µg/ml in the presence of anti-CD3 immobilized at 20 ng/ml.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETA PVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT KRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPL GEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRT HHTG -
Predicted molecular weight
24 kDa including tags -
Amino acids
22 to 225 -
Tags
His tag C-Terminus -
Additional sequence information
AAH20063. Extracellular domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab182681 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
DTT-reduced CD84 protein migrates as 35-45 kDa due to glycosylation.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- CD_antigen=CD84
- CD84
- CD84 antigen
see all -
Function
Plays a role as adhesion receptor functioning by homophilic interactions and by clustering. Recruits SH2 domain-containing proteins SH2D1A/SAP. Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seen be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A/SAP-dependent pathway. May serve as a marker for hematopoietic progenitor cells. -
Tissue specificity
Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cells. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Developmental stage
Expression is slightly increased in naive B-cells after the first dividion. By contrast, expression on memory B-cells decreased with each successive division. -
Domain
ITSM (immunoreceptor tyrosine-based switch motif) motif is a cytoplasmic motif which may bind SH2D1A. -
Post-translational
modificationsPhosphorylated by tyrosine-protein kinase LCK on tyrosine residues following ligation induced by agonist monoclonal antibody. The association with SH2D1A/SAP is dependent of tyrosines phosphorylation of its cytoplasmic domain Phosphorylated on Tyr-296 and Tyr-316 following platelet aggregation.
N-glycosylated. -
Cellular localization
Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab182681 has not yet been referenced specifically in any publications.