Recombinant human Coxsackie Adenovirus Receptor/hCAR protein (His tag) (ab168893)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Coxsackie Adenovirus Receptor/hCAR protein (His tag)
See all Coxsackie Adenovirus Receptor/hCAR proteins and peptides -
Biological activity
Measured by the ability of immobilized ab168893 to support the adhesion of mouse neutrophils. When 50000 cells/well are added to Coxsackie Adenovirus Receptor coated plates (4 µg/mL and 100 µL/well ), approximately 20% - 50% will adhere specifically after 60 minutes at 37?. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQ VIILYSGDKI YDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGT YQCKVKKAPGVANKKIHLVVLV KPSGARCYVDGSEEIGSDFKIKCEPK EGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISV KNASSEYSGTYSCT VRNRVGSDQCLLRLNVVPPSNKAG -
Predicted molecular weight
25 kDa including tags -
Amino acids
20 to 237 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab168893 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as Coxsackie Adenovirus Receptor
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C.
pH: 7.40
Constituent: 95% PBS
Lyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage
General Info
-
Alternative names
- 46 kD coxsackievirus and adenovirus receptor CAR protein
- 46 kD coxsackievirus and adenovirus receptor protein
- CAR
see all -
Function
Component of the epithelial apical junction complex that is essential for the tight junction integrity. Proposed to function as a homophilic cell adhesion molecule. Recruits MPDZ to intercellular contact sites. Probably involved in transepithelial migration of polymorphonuclear leukocytes (PMN) through adhesive interactions with AMICA1/JAML located in the plasma membrane of PMN. -
Tissue specificity
Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromuscular junction and isoform 2 is found in blood vessels. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. In heart expressed in subendothelial layers of the vessel wall but not in the luminal endothelial surface. Expression is elevated in hearts with dilated cardiomyopathy. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains. -
Domain
The Ig-like C2-type 1 domain probably mediates homodimerization and interaction with JAML.
The PDZ-binding motif mediates interaction with MPDZ and BAIAP1. -
Post-translational
modificationsN-glycosylated.
Palmitoylated on Cys-259 and/or Cys-260; required for proper localization to the plasma membrane. -
Cellular localization
Secreted and Cell membrane. Cell junction > tight junction. Cell junction > adherens junction. Basolateral cell membrane. In epithelial cells localizes to the apical junction complex composced of tight and adherens junctions. In airway epithelial cells localized to basolateral membrane but not to apical surface. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab168893 has been referenced in 1 publication.
- Herrmann L et al. Human Coxsackie- and adenovirus receptor is a putative target of neutrophil elastase-mediated shedding. Mol Biol Rep 49:3213-3223 (2022). PubMed: 35122600