Recombinant human IGF2 protein (ab155617)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Achieve higher consistency and quality standards with a premium grade bioactive protein
- High batch-to-batch consistency
- Optimal bioactivity
- Guaranteed identical to human native proteins
- >95% purity
- Ultra-low endotoxin levels: <0.005 Eu/µg
- Carrier and tag free
Description
-
Product name
Recombinant human IGF2 protein
See all IGF2 proteins and peptides -
Biological activity
Measured in a serum-free cell proliferation assay using MCF7 Human breast cancer cells.
The ED50 for this effect is typically 2-10 ng/ml. -
Purity
> 95 % SDS-PAGE.
Lyophilized from 0.22µm filtered solution -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE -
Predicted molecular weight
34 kDa -
Molecular weight information
The protein migrates as 35-38 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. -
Amino acids
25 to 91 -
Tags
Fc tag N-Terminus -
Additional sequence information
This protein carries a human IgG1 Fc tag at the N-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab155617 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 5% Trehalose, 0.75% Glycine, 0.605% TrisThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 1 mg/ml.
General Info
-
Alternative names
- C11orf43
- IGF 2
- IGF II
see all -
Function
The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.
Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. -
Involvement in disease
Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS) [MIM:180860]. SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. -
Sequence similarities
Belongs to the insulin family. -
Post-translational
modificationsO-glycosylated with a core 1 or possibly core 8 glycan. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab155617 has not yet been referenced specifically in any publications.