Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab202801)
Key features and details
- Expression system: Escherichia coli
- Purity: > 96% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3
See all MIP-1 alpha/CCL3 proteins and peptides -
Biological activity
Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml.
-
Purity
> 96 % SDS-PAGE.
> 96 % by HPLC analysis. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA -
Predicted molecular weight
8 kDa -
Amino acids
23 to 92 -
Additional sequence information
This product is the mature full length protein from aa 23 to 92. The signal peptide is not included.
-
-
Description
Recombinant human MIP-1 alpha/CCL3 protein
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab202801 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.58% Sodium chloride, 99% Phosphate Buffer
Lyophilised from a 0.2mm filtered concentrated solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C C motif chemokine 3
- CCL 3
- CCL3
see all -
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab202801 has not yet been referenced specifically in any publications.