Recombinant human Macrophage inflammatory protein 5 (ab202788)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant human Macrophage inflammatory protein 5
See all Macrophage inflammatory protein 5 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. Determined by its ability to chemoattract Human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI -
Predicted molecular weight
10 kDa -
Amino acids
22 to 113 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab202788 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.58% Sodium chloride, 99% Phosphate BufferThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C-C motif chemokine 15
- C-C motif chemokine ligand 15
- CC chemokine 3
see all -
Function
Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15. -
Tissue specificity
Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab202788 has not yet been referenced specifically in any publications.