Recombinant human ENO1 protein (ab167976)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human ENO1 protein
See all ENO1 proteins and peptides -
Biological activity
Specific activity: > 13 units/ml. One unit will convert 1.0 µmole of 2-phosphoglycerate to phosphoenol pyruvate per minute at pH 7.5 at 25°C.
-
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK -
Predicted molecular weight
47 kDa -
Amino acids
1 to 434
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167976 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Additional notes
This product is manufactured by BioVision, an Abcam company and was previously called 6363 Human Recombinant Alpha-Enolase. 6363-100 is the same size as the 100 µg size of ab167976.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.012% Magnesium sulphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- 2 phospho D glycerate hydro lyase
- 2-phospho-D-glycerate hydro-lyase
- Alpha enolase
see all -
Function
Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor. -
Tissue specificity
The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. -
Pathway
Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5. -
Sequence similarities
Belongs to the enolase family. -
Developmental stage
During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells. -
Post-translational
modificationsISGylated. -
Cellular localization
Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab167976 has been referenced in 1 publication.
- Chen FK et al. Acute progressive paravascular placoid neuroretinopathy with negative-type electroretinography in paraneoplastic retinopathy. Doc Ophthalmol 134:227-235 (2017). PubMed: 28382556