Recombinant human PIN4 protein (ab105618)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE, MS
Description
-
Product name
Recombinant human PIN4 protein
See all PIN4 proteins and peptides -
Biological activity
Specific activity is > 700 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1 nmole of suc-AAPF-pNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.
-
Purity
> 85 % SDS-PAGE.
ab105618 was purified using conventional chromatography. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKG KSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAM EKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSG MDKPVFTDPPVKTKFGYHIIMVEGRK -
Predicted molecular weight
19 kDa including tags -
Amino acids
1 to 156 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab105618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.00174% PMSF, 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- EPVH
- Eukaryotic parvulin homolog
- hEPVH
see all -
Function
Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.
Isoform 2 binds to double-stranded DNA. -
Tissue specificity
Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed. -
Sequence similarities
Belongs to the ppiC/parvulin rotamase family. PIN4 subfamily.
Contains 1 PpiC domain. -
Domain
The PPIase domain enhances mitochondrial targeting. -
Post-translational
modificationsPhosphorylated. Isoform 1 phosphorylation occurs both in the nucleus and the cytoplasm. Isoform 1 phosphorylation at Ser-19 does not affect its PPIase activity but is required for nuclear localization, and the dephosphorylation is a prerequisite for the binding to DNA. The unphosphorylated isoform 1 associates with the pre-rRNP complexes in the nucleus.
Isoform 2 is sumoylated by SUMO2 and SUMO3. -
Cellular localization
Mitochondrion. Mitochondrion matrix. Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide and Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab105618 has not yet been referenced specifically in any publications.