Recombinant human TARC/CCL17 protein (Active) (ab202781)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human TARC/CCL17 protein (Active)
See all TARC/CCL17 proteins and peptides -
Biological activity
Determined by its ability to chemoattract Human T cells using a concentration range of 1.0-10.0 ng/ml.
-
Purity
> 97 % SDS-PAGE.
and HPLC analyses -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS -
Predicted molecular weight
11 kDa -
Amino acids
24 to 94 -
Additional sequence information
Mature full length protein with the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab202781 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
This product was previously labelled as TARC
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.87% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- A-152E5.3
- A152E53
- ABCD 2
see all -
Function
Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. -
Tissue specificity
Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab202781 has not yet been referenced specifically in any publications.