Recombinant human TNFSF18/GITRL protein (ab50093)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human TNFSF18/GITRL protein
See all TNFSF18/GITRL proteins and peptides -
Biological activity
Biological activity: Use at a concentration of 1 - 10 ng/ml to stimulate IL8 production by human PBMC. Results may vary with PBMC donors.
-
Purity
> 95 % SDS-PAGE.
Greater than 98% by SDS-PAGE and HPLC analyses. -
Expression system
Escherichia coli -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
METAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQ VAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDL IFNSEHQVLKNNTYWGIILLANPQFI -
Amino acids
52 to 176 -
Additional sequence information
Contains 127 amino acid residues corresponding to the extracellular domain of TNFS18 / GITRL.
-
Specifications
Our Abpromise guarantee covers the use of ab50093 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Protein previously known as TNFSF18.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4 degC for 1 week or -20 degC for future use.
General Info
-
Alternative names
- Activation inducible TNF related ligand
- Activation-inducible TNF-related ligand
- AITR ligand
see all -
Function
Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues. -
Tissue specificity
Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab50093 has not yet been referenced specifically in any publications.