Recombinant human TRAIL protein (ab157345)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: WB, Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human TRAIL protein
See all TRAIL proteins and peptides -
Biological activity
Binds to Human and mouse TRAIL receptors and Human osteoprotegerin (OPG).Induces apoptosis in a concentration range of 1-100ng/ml if applied with a cross-linking enhancer.
Note: ab157345 does not significantly induce apoptosis in the absence of an enhancer. -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG -
Predicted molecular weight
28 kDa including tags -
Amino acids
95 to 281 -
Tags
DDDDK tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab157345 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Binds to Human and mouse TRAIL receptors and Human osteoprotegerin (OPG).Induces apoptosis in a concentration range of 1-100ng/ml if applied with a cross-linking enhancer.
Note: ab157345 does not significantly induce apoptosis in the absence of an enhancer. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water to a final concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- Apo 2 ligand
- APO 2L
- Apo-2 ligand
see all -
Function
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis. -
Tissue specificity
Widespread; most predominant in spleen, lung and prostate. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab157345 has been referenced in 1 publication.
- Ji T et al. A Substance P (SP)/Neurokinin-1 Receptor Axis Promotes Perineural Invasion of Pancreatic Cancer and Is Affected by lncRNA LOC389641. J Immunol Res 2022:5582811 (2022). PubMed: 35600049