Active human c Abl (mutated F317 I) protein fragment (ab207124)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASG DNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHS WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRI NTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVY GVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKED TMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEIMTYGNLLDY LRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHL VKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFG VLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACW QWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAP ELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKE RGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDG QPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRES GGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGA KDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVT RGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAP ASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVR RHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEA VLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPI SPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGA ITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQ MRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISD IVQR
    • Molecular weight
      160 kDa including tags
    • Amino acids
      27 to 1130
    • Modifications
      mutated F317 I
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      NM_005157.

Specifications

Our Abpromise guarantee covers the use of ab207124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab207124 was determined to be 100 nmol/min/mg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 70 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Abelson murine leukemia viral oncogene homolog 1
    • Abelson tyrosine protein kinase 1
    • ABL
    • Abl 1
    • ABL proto oncogene 1 non receptor tyrosine kinase
    • ABL1
    • ABL1_HUMAN
    • bcr/abl
    • bcr/c abl oncogene protein
    • c ABL
    • c abl oncogene 1 non receptor tyrosine kinase
    • c abl oncogene 1 receptor tyrosine kinase
    • c ABL1
    • JTK7
    • p150
    • Proto oncogene tyrosine protein kinase ABL1
    • Proto-oncogene c-Abl
    • Tyrosine-protein kinase ABL1
    • v abl
    • v abl Abelson murine leukemia viral oncogene homolog 1
    see all
  • Function
    Protein kinase that regulates key processes linked to cell growth and survival. Regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. Localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. Regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. Phosphorylates PSMA7 that leads to an inhibition of proteasomal activity and cell cycle transition blocks.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Note=A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Phosphorylated by PRKDC (By similarity). DNA damage-induced activation of c-Abl requires the function of ATM and Ser-446 phosphorylation (By similarity). Phosphorylation on Thr-735 is required for binding 14-3-3 proteins for cytoplasmic translocation.
    Isoform IB is myristoylated on Gly-2.
  • Cellular localization
    Cytoplasm > cytoskeleton. Nucleus. Sequestered into the cytoplasm through interaction with 14-3-3 proteins and Nucleus membrane. The myristoylated c-ABL protein is reported to be nuclear.
  • Information by UniProt

Active human c Abl (mutated F317 I) protein fragment images

  • SDS-PAGE analysis of ab207124 which was determined to be >70% pure by densitometry.

  • The specific activity of ab207124 was determined to be 100 nmol/min/mg.

References for Active human c Abl (mutated F317 I) protein fragment (ab207124)

ab207124 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab207124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up