Recombinant mouse BAFF protein (ab157285)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse BAFF protein
See all BAFF proteins and peptides -
Biological activity
Binds to Human (weak) and mouse BCMA, TACI and BAFF-R.
Mediates splenocyte survival. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIAD SDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYT DPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIAR LEEGDEIQLAIPRENAQISRNGDDTFFGALKLL -
Predicted molecular weight
17 kDa including tags -
Amino acids
127 to 309 -
Tags
DDDDK tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab157285 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Binds to Human (weak) and mouse BCMA, TACI and BAFF-R.
Mediates splenocyte survival. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water to a concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or other carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- ApoL related ligand TALL 1
- B cell Activating Factor
- B lymphocyte stimulator
see all -
Function
Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B-and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response. -
Tissue specificity
Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart, lung, fetal liver, thymus, and pancreas. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsThe soluble form derives from the membrane form by proteolytic processing.
N-glycosylated. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
SDS-PAGE analysis: Lane 1: MWt Marker, Lane 2: 1 μg ab157285, stained with Imperial stain
-
ab157285 mediates survival of freshly isolated splenocytes.
Method: On day 0 splenocytes were isolated from a freshly collected C57Bl6 spleen. An aliquot of the splenocytes was analyzed on FACS and gated on the SSC-FSC panel. FACS settings were saved. The rest of the cells was put in culture with media alone or with increasing concentrations of ab157285 as indicated. After three days in culture, cells were harvested and analyzed on FACS with the saved setting. Splenocytes Survival Index (ratio % living/% dead cells) was calculated and plotted.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab157285 has been referenced in 1 publication.
- Yarchoan M et al. Effects of B cell-activating factor on tumor immunity. JCI Insight 5:N/A (2020). PubMed: 32434989