Recombinant mouse CCL28/MEC protein (ab201426)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant mouse CCL28/MEC protein
See all CCL28/MEC proteins and peptides -
Biological activity
Fully biologically active when compared to standard. Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC analysis -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKR RRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHR TRGTHRHEASR -
Predicted molecular weight
13 kDa -
Amino acids
20 to 130 -
Additional sequence information
A single, non-glycosylated polypeptide chain containing 111 amino acids.
-
Specifications
Our Abpromise guarantee covers the use of ab201426 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Additional notes
This product was previously labelled as CCL28
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C C motif chemokine ligand 28
- C-C motif chemokine 28
- CC chemokine CCL28
see all -
Function
Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. -
Tissue specificity
Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab201426 has not yet been referenced specifically in any publications.