Recombinant mouse Eotaxin protein (ab201417)
Key features and details
- Expression system: Escherichia coli
- Purity: > 96% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant mouse Eotaxin protein
See all Eotaxin proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.
-
Purity
> 96 % SDS-PAGE.
> 96 % by HPLC analysis -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEIC ADPKKKWVQDATKHLDQKLQTPKP -
Predicted molecular weight
8 kDa -
Amino acids
24 to 97 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab201417 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C-C motif chemokine 11
- CCL 11
- CCL11
see all -
Function
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsO-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab201417 has not yet been referenced specifically in any publications.