Recombinant mouse CCL21 protein (ab201361)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant mouse CCL21 protein
See all CCL21 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC analysis. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPE LCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCK RTEQTQPSRG -
Predicted molecular weight
12 kDa -
Amino acids
24 to 133 -
Additional sequence information
Single, non-glycosylated polypeptide chain containing 110 amino acids. This product is the mature full length protein from aa 24 to 133. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab201361 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer
Lyophilized from a 0.2µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- 6Ckine
- Beta chemokine exodus 2
- Beta-chemokine exodus-2
see all -
Function
Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. -
Tissue specificity
Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab201361 has been referenced in 1 publication.
- Zhang L et al. Artesunate Therapy Alleviates Fracture-Associated Chronic Pain After Orthopedic Surgery by Suppressing CCL21-Dependent TREM2/DAP12 Inflammatory Signaling in Mice. Front Pharmacol 13:894963 (2022). PubMed: 35721188