Recombinant rat FGF21 protein (ab202819)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: > 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant rat FGF21 protein
See all FGF21 proteins and peptides -
Biological activity
ab202819 is fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/mL, corresponding to a specific activity of > 2.0 × 103 IU/mg in the presence of 5 µg/mL of rMuKlotho-β and 10 μg/mL of heparin.
-
Purity
> 95 % SDS-PAGE.
Purity is determined by SDS-PAGE and HPLC analyses. -
Endotoxin level
> 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
AYPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSP ESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELL LKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPG VLPPEPPDVGSSDPLSMVEPLQGRSPSYAS -
Predicted molecular weight
20 kDa -
Amino acids
29 to 208 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.
-
Specifications
Our Abpromise guarantee covers the use of ab202819 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 2.9% Sodium chloride, 97% PBS
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Reconstituted protein should be stored in working aliquots and stored at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- FGF 21
- FGF-21
- Fgf21
see all -
Function
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab202819 has not yet been referenced specifically in any publications.