Recombinant rat PDGF AA protein (ab202796)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant rat PDGF AA protein
See all PDGF AA proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/mL, corresponding to a specific activity of > 2.0 × 105 IU/mg.
-
Purity
> 98 % SDS-PAGE.
> 98 % by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLN PDHREEETDVR -
Predicted molecular weight
25 kDa -
Amino acids
87 to 196 -
Additional sequence information
This product is the mature full length protein from aa 87 to 196. The signal peptide and propeptide are not included. Disulfide-linked homodimeric protein.
-
Specifications
Our Abpromise guarantee covers the use of ab202796 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
Lyophilised from a 0.2 µm filtered concentrated solution containing 30 % Acetonitrile.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- PDGF A
- PDGF A chain
- PDGF subunit A
see all -
Function
Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Domain
The long form contains a basic insert which acts as a cell retention signal. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab202796 has been referenced in 1 publication.
- Dong Z et al. Identification lncRNA LOC102551149/miR-23a-5p pathway in hepatic fibrosis. Eur J Clin Invest 50:e13243 (2020). PubMed: 32306379