Anti-Activin Receptor Type IIA antibody (ab231057)

Overview

  • Product name
    Anti-Activin Receptor Type IIA antibody
    See all Activin Receptor Type IIA primary antibodies
  • Description
    Rabbit polyclonal to Activin Receptor Type IIA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Cow, Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Cow Activin Receptor Type IIA aa 192-325. (Expressed in E.coli).
    Sequence:

    LQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGM KHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCH IAETMARGLAYLHEDIPGLKDGHKPAISHRDIKS


    Database link: Q28043

  • Positive control
    • WB: Cow skeletal muscle lysate; HepG2 cell lysate; Recombinant cow Activin Receptor Type IIA protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.

Target

Images

  • Anti-Activin Receptor Type IIA antibody (ab231057) at 2 µg/ml + Recombinant cow Activin Receptor Type IIA protein

    Predicted band size: 58 kDa

  • Anti-Activin Receptor Type IIA antibody (ab231057) at 1 µg/ml + Cow skeletal muscle lysate

    Predicted band size: 58 kDa

  • Anti-Activin Receptor Type IIA antibody (ab231057) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 58 kDa

References

ab231057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up