Anti-Adenosine A2b Receptor antibody (ab222901)

Overview

  • Product name
    Anti-Adenosine A2b Receptor antibody
    See all Adenosine A2b Receptor primary antibodies
  • Description
    Rabbit polyclonal to Adenosine A2b Receptor
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Adenosine A2b Receptor aa 292-332 (C terminal).
    Sequence:

    YRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL


    Database link: P29275

  • Positive control
    • WB: Mouse brain tissue lysate. ICC/IF: HepG2 cells. IHC-P: Human brain and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab222901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Adenosine A2b Receptor (green) using ab222901 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L) .

  • Anti-Adenosine A2b Receptor antibody (ab222901) at 1/500 dilution + mouse brain tissue

    Secondary
    Goat polyclonal to rabbit IgG at 1/500000 dilution
  • Paraffin embedded human brain tissue stained for Adenosine A2b Receptor with ab222901 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human kidney tissue stained for Adenosine A2b Receptor with ab222901 (1/100 dilution) in immunohistochemical analysis.

References

ab222901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up